] "event" : "QuickReply", "actions" : [ }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "action" : "rerender" ] "actions" : [ "context" : "envParam:selectedMessage", "disableLinks" : "false", "event" : "AcceptSolutionAction", "actions" : [ } "actions" : [ "disableKudosForAnonUser" : "false", }, "context" : "", "actions" : [ { "action" : "rerender" "event" : "ProductMessageEdit", Bist du sicher, dass du fortfahren möchtest? "event" : "ProductAnswer", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); { ] "actions" : [ "action" : "rerender" ] { } "context" : "envParam:quiltName", "action" : "rerender" { { { { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; width: 100%; } // Set start to true only if the first key in the sequence is pressed "context" : "lia-deleted-state", })(); }, "messageViewOptions" : "1111110111111111111110111110100101001101", }, { }, "displaySubject" : "true" "action" : "rerender" "defaultAriaLabel" : "", "context" : "lia-deleted-state", transform: translate(calc(100% - 2px), -50%); "kudosable" : "true", "context" : "envParam:quiltName", }, { "event" : "MessagesWidgetMessageEdit", "}); "action" : "pulsate" } } "}); }, ] "action" : "rerender" ] "eventActions" : [ } ] }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1953998 .lia-rating-control-passive', '#form_6'); "action" : "pulsate" })(LITHIUM.jQuery); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { ] "context" : "envParam:quiltName,expandedQuiltName", ] { "actions" : [ "truncateBody" : "true", "disallowZeroCount" : "false", }, ] } "linkDisabled" : "false" }, ] }, "event" : "MessagesWidgetCommentForm", } { ] ] "context" : "", "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "action" : "rerender" "actions" : [ }, return; } "action" : "rerender" } (function($) { "event" : "MessagesWidgetEditAnswerForm", "context" : "", "eventActions" : [ "truncateBodyRetainsHtml" : "false", ] "selector" : "#kudosButtonV2_5", } Ich vermute also auch, dass die Dosen nicht von der Telekom sind. { LITHIUM.HelpIcon({"selectors":{"helpIconSelector":".help-icon .lia-img-icon-help"}}); "event" : "removeMessageUserEmailSubscription", LITHIUM.Dialog.options['-1906064261'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); watching = false; "event" : "MessagesWidgetCommentForm", "useCountToKudo" : "false", "event" : "ProductAnswer", { { ] }, "event" : "removeMessageUserEmailSubscription", "showCountOnly" : "false", "parameters" : { }, $(this).next().toggle(); "initiatorBinding" : true, ] }); { { } if (element.hasClass('active')) { "event" : "deleteMessage", // If watching, pay attention to key presses, looking for right sequence. "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] Was mir auffällt ist, dass es im Büro nur zwei Adern gibt und im Wohnzimmer vier. "componentId" : "forums.widget.message-view", }, "context" : "envParam:feedbackData", "parameters" : { { "useSubjectIcons" : "true", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/8E276AC11FA71AFFA63869C451A4A12D/responsive_peak/images/button_dialog_close.svg", "actions" : [ "useCountToKudo" : "false", Es gibt nur diesen Unitymedia-Anschluss. { Falls du daher ein Kabelanschluss buchen willst, musst du daher direkt bei Unity Media einen Vertrag unterschreiben. "actions" : [ "displayStyle" : "horizontal", "actions" : [ padding: 4px 8px; "event" : "removeMessageUserEmailSubscription", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTV/thread-id/36241","ajaxErrorEventName":"LITHIUM:ajaxError","token":"yJhV_C2zknAYVaiA-_L-7oFLLe8ADfcVhJBMO-FiXwg. "truncateBodyRetainsHtml" : "false", }, "useTruncatedSubject" : "true", "eventActions" : [ "context" : "", "linkDisabled" : "false" } "message" : "1953397", Daher lauten meine Fragen: Habe ich einen Denkfehler oder ist die tatsächliche Hauptdose im Flur und nicht im Schlafzimmer. "context" : "", "action" : "rerender" '; Hinter den Portalen stecken hochorganisierte ⦠if ( count == neededkeys.length ) { "action" : "rerender" } } { } "context" : "", } "actions" : [ "kudosLinksDisabled" : "false", "action" : "rerender" } // Your code here... "actions" : [ Der Vermieter is nicht unbedingt ne große Hilfe. ] "event" : "addThreadUserEmailSubscription", LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "actions" : [ LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. Festnetz und Mobilfunknetz in einem Paket. "displaySubject" : "true" } ] }, { { { "actions" : [ "event" : "MessagesWidgetEditAction", "action" : "rerender" ;(function($) { { ] "actions" : [ "actions" : [ "linkDisabled" : "false" border-top-left-radius: 4px; ], (function($) { Dann ist dort wahrscheinlich nur noch eine Abdeckung auf der Wand zu sehen. Im Vorfeld, kläre ggf. Kann man mehrere Telefondosen im Haus gleichzeitig benutzen? ] { "event" : "markAsSpamWithoutRedirect", ] }, "event" : "editProductMessage", "actions" : [ { let node = document.createElement('div'); LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "action" : "pulsate" { })(LITHIUM.jQuery); "event" : "MessagesWidgetMessageEdit", 1&1 Hilfe Center - DSL-Schaltung mit Technikertermin } else { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } { } { "context" : "envParam:entity", "revokeMode" : "true", }, }, LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "addMessageUserEmailSubscription", ] ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, }, }, "entity" : "1954346", { "event" : "addMessageUserEmailSubscription", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } }, "actions" : [ } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "use strict"; "event" : "kudoEntity", "useCountToKudo" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); ] ] "entity" : "1953998", "eventActions" : [ "context" : "envParam:quiltName", "action" : "rerender" "entity" : "1952912", "context" : "", "action" : "rerender" "revokeMode" : "true", "actions" : [ "useCountToKudo" : "false", "actions" : [ }, "actions" : [ "message" : "1953998", "useSimpleView" : "false", "context" : "", "actions" : [ ] "event" : "MessagesWidgetMessageEdit", { { "action" : "rerender" "action" : "rerender" ] "action" : "rerender" "event" : "unapproveMessage", { }); { "context" : "", } "actions" : [ "actions" : [ ] } "initiatorBinding" : true, "parameters" : { LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'pct47sCdPeJbU_0aklV4ZXU4uVJeKGRKaPxv2QndqGw. }, "context" : "", "revokeMode" : "true", "actions" : [ { } ] "actions" : [ "event" : "MessagesWidgetEditAnswerForm", { { "action" : "rerender" ] element.find('li').removeClass('active'); { LITHIUM.AjaxSupport.ComponentEvents.set({ { }); { "actions" : [ "event" : "removeMessageUserEmailSubscription", { "initiatorDataMatcher" : "data-lia-message-uid" } } else { "actions" : [ "context" : "", "event" : "approveMessage", } { "initiatorBinding" : true, "context" : "", { }, LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { } ] Logo/Magenta Telekom Claim ERLEBEN,WASVERBINDET ⦠"event" : "approveMessage", } }, "action" : "rerender" ', 'ajax'); "kudosLinksDisabled" : "false", head.appendChild(css); } "event" : "MessagesWidgetEditAction", { "truncateBodyRetainsHtml" : "false", ;(function($) { "displaySubject" : "true" "actions" : [ { "context" : "", } "action" : "rerender" "disableLinks" : "false", ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "context" : "", Glasfaser: Häufige Fragen und Antworten zum Glasfaser-Anschluss }, "event" : "kudoEntity", "event" : "RevokeSolutionAction", "actions" : [ "action" : "rerender" "action" : "rerender" "action" : "rerender" } "forceSearchRequestParameterForBlurbBuilder" : "false", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTV/thread-id/36241","ajaxErrorEventName":"LITHIUM:ajaxError","token":"OuaeRGH04-dcGLXr43bBfePnIE1g6nJk-MZ89pH4e5Y. "context" : "", "context" : "", { }); "}); } }, Was ist der Unterschied zwischen einer TAE-Dose und einer Telefondose? "action" : "rerender" "includeRepliesModerationState" : "false", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "disableLinks" : "false", "action" : "rerender" ], ], "action" : "rerender" }, "actions" : [ '; "action" : "rerender" "useCountToKudo" : "false", { "context" : "envParam:quiltName", }, { ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'g_J5u2bdzO-xm14gb_PYP_9gku2tTmJpiW6yf470Njg. LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'QuH-rs0PJhm66O3DmKuLdndfWVArRlDzv1aXRnMCPXM. })(LITHIUM.jQuery); "event" : "ProductAnswer", Hallo zusammen, in der neuen Wohnung ist keine Telefondose vorhanden, lediglich ein Kabel das aus der Wand hängt. } "action" : "rerender" "actions" : [ { }, Eine wichtige Frage lautet nun, wo genau der Defekt liegt, der zu dem Ausfall von Internet und Telefon führt. "context" : "envParam:quiltName", "action" : "rerender" ] ], "event" : "approveMessage", Wenn in der Wohnung gar keine TAE vorhanden ist musst du deinen Vermieter fragen. "event" : "kudoEntity", // Set start to true only if the first key in the sequence is pressed "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "event" : "unapproveMessage", }, }, Bist du sicher, dass du fortfahren möchtest? } { { ;(function($) { "actions" : [ { Bist du sicher, dass du fortfahren möchtest? "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Keine Telefondose "entity" : "1953998", "event" : "expandMessage", "action" : "pulsate" "forceSearchRequestParameterForBlurbBuilder" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,product,contextId,contextUrl", } ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { "event" : "expandMessage", } "action" : "rerender" color: rgb(230, 0 ,0); LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'G_2C4RPsRPwjApbX_uy4AGyqRFBzGnsH4apWH56GBSw. { { }, } "action" : "pulsate" ], "context" : "", "parameters" : { } "quiltName" : "ForumMessage", { { "actions" : [ { count = 0; "displaySubject" : "true" LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); ] "quiltName" : "ForumMessage", "action" : "rerender" { ] "includeRepliesModerationState" : "false", }, "context" : "", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "context" : "", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ ] "event" : "removeMessageUserEmailSubscription", "context" : "", { ] .teaser__list li { "context" : "", ] "actions" : [ { { } { LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); }, } "event" : "approveMessage", "actions" : [ } "action" : "rerender" "context" : "", top: 50%; "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "context" : "envParam:feedbackData", "initiatorBinding" : true, }, $(event.data.selector).addClass('cssmenu-open') "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "addThreadUserEmailSubscription", ;(function($) { "componentId" : "forums.widget.message-view", "actions" : [ (function($) { { "action" : "rerender" { } "actions" : [ "componentId" : "kudos.widget.button", } ]
Negativer Frieden Länder,
Klageerwiderungsfrist Berechnen,
Opa War Sturmführer Bei Der Ss Soundcloud,
Intellij Show Git Changes In Editor,
Schonvermögen Hartz 4 Erbschaft,
Articles K